PITPNB Antibody - middle region : FITC

PITPNB Antibody - middle region : FITC
SKU
AVIARP54894_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PITPNB

Key Reference: Morgan,C.P., (2006) Biochem. J. 398 (3), 411-421

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol transfer protein beta isoform

Protein Size: 271

Purification: Affinity Purified
More Information
SKU AVIARP54894_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54894_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23760
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×