PLDN Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLDN

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 6

Protein Size: 172

Purification: Affinity Purified

• SKU: AVIARP54889_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54889_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26258
• Host: Rabbit