PLEKHA9 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLEKHA9

Key Reference: Ishibashi,T., (2005) J. Biochem. 137 (5), 617-623

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative protein PLEKHA9

Protein Size: 391

Purification: Affinity Purified

• SKU: AVIARP56768_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56768_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51054
• Host: Rabbit