PLSCR1 Antibody - N-terminal region : FITC

PLSCR1 Antibody - N-terminal region : FITC
SKU
AVIARP57513_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipid scramblase 1

Protein Size: 318

Purification: Affinity Purified
More Information
SKU AVIARP57513_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57513_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5359
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×