PMM1 Antibody - N-terminal region : HRP

PMM1 Antibody - N-terminal region : HRP
SKU
AVIARP56401_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PMM1

Key Reference: Barone,R., J. Inherit. Metab. Dis. 30 (1), 107 (2007)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphomannomutase 1

Protein Size: 262

Purification: Affinity Purified
More Information
SKU AVIARP56401_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56401_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5372
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×