PNN Antibody - N-terminal region : FITC

PNN Antibody - N-terminal region : FITC
SKU
AVIARP56403_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent mul

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNN

Key Reference: Alpatov,R., (2008) Mol. Cell. Biol. 28 (5), 1584-1595

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pinin

Protein Size: 717

Purification: Affinity Purified
More Information
SKU AVIARP56403_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56403_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5411
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×