Pnrc2 Antibody - N-terminal region : Biotin

Pnrc2 Antibody - N-terminal region : Biotin
SKU
AVIARP57027_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Pnrc2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. It may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. It is required for UPF1/RENT1 localization to the P-body.It also acts as a nuclear receptor coactivator. It may play a role in controlling the energy balance between energy storage and energy expenditure.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich nuclear receptor coactivator 2

Protein Size: 134

Purification: Affinity Purified
More Information
SKU AVIARP57027_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57027_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 100125373
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×