POLB Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance. Also see POLA (MIM 312040).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLB

Key Reference: Batra,V.K., (2008) Mol. Cell 30 (3), 315-324

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase beta

Protein Size: 335

Purification: Affinity Purified

• SKU: AVIARP56406_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56406_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5423
• Host: Rabbit