POLM Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLM

Key Reference: Juarez,R., (2006) Nucleic Acids Res. 34 (16), 4572-4582

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed DNA/RNA polymerase mu

Protein Size: 494

Purification: Affinity Purified

• SKU: AVIARP54928_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54928_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27434
• Host: Rabbit