POLM Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLM

Key Reference: Juarez,R., (2006) Nucleic Acids Res. 34 (16), 4572-4582

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA-directed DNA/RNA polymerase mu

Protein Size: 494

Purification: Affinity Purified

• SKU: AVIARP54928_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54928_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27434
• Host: Rabbit