POP5 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: POP5 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.POP5 is also a component of RNase MRP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POP5

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribonuclease P/MRP protein subunit POP5

Protein Size: 163

Purification: Affinity Purified

Subunit: POP5

• SKU: AVIARP56773_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56773_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51367
• Host: Rabbit