PPM1J Antibody - C-terminal region : Biotin

PPM1J Antibody - C-terminal region : Biotin
SKU
AVIARP54745_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PPM1J

Key Reference: Komaki,K., Biochim. Biophys. Acta 1630 (2-3), 130-137 (2003)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1J

Protein Size: 505

Purification: Affinity Purified
More Information
SKU AVIARP54745_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54745_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 333926
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×