Ppp1r7 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ppp1r7 is a regulatory subunit of protein phosphatase 1.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: SHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 1 regulatory subunit 7

Protein Size: 360

Purification: Affinity Purified

Subunit: 7

• SKU: AVIARP56408_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56408_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 301618
• Host: Rabbit