PPP2R1A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. PPP2R1A is an alpha isoform of the constant regulatory subunit A.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform EMBL EAW72066.1

Protein Size: 589

Purification: Affinity Purified

• SKU: AVIARP57780_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57780_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5518
• Host: Rabbit