PPP2R1B Antibody - N-terminal region : Biotin

PPP2R1B Antibody - N-terminal region : Biotin
SKU
AVIARP57781_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R1B

Key Reference: Chou,H.C., (2007) Cancer Lett. 253 (1), 138-143

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ76434, highly similar to Homo sapiens protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform (PPP2R1B), transcript variant 2, mRNA EMBL BAF84964.1

Protein Size: 667

Purification: Affinity Purified

Subunit: A beta isoform
More Information
SKU AVIARP57781_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57781_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5519
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×