PPP6R1 Antibody - N-terminal region : HRP

PPP6R1 Antibody - N-terminal region : HRP
SKU
AVIARP55109_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 300141) (Stefansson and Brautigan, 2006 [PubMed 16769727]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP6R1

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 6 regulatory subunit 1

Protein Size: 881

Purification: Affinity Purified
More Information
SKU AVIARP55109_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55109_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22870
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×