Prkar1a Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Prkar1a is a regulatory subunit of cAMP-dependent protein kinase (PKA); negatively regulates meiosis .

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prkar1a

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase type I-alpha regulatory subunit

Protein Size: 381

Purification: Affinity Purified

• SKU: AVIARP57831_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57831_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 25725
• Host: Rabbit