PRKCG Antibody - middle region : HRP

PRKCG Antibody - middle region : HRP
SKU
AVIARP56426_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKCG

Key Reference: Wieczorek,S., (2007) Mov. Disord. 22 (14), 2135-2136

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein kinase C gamma type

Protein Size: 697

Purification: Affinity Purified
More Information
SKU AVIARP56426_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56426_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5582
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×