Uniprot: P01236
Gene Name: PRL
Immunogen: Recombinant human PRL
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 60%
Core Sequence: LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 62%, Pig - 77%, Cynomolgus monkey - 98%
Alternative gene names: /
Alternative protein names: Prolactin; PRL
Protein name: Prolactin
Product panel: IHC Pathology
Clone No.: KAA114_11E11
Antigen Species: Human
Target Name: PRL
IHC Verification: -
IHC Dilution: N/A
WB Verification: -
WB Dilution: N/A
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: succeed
Sandwich ELISA Dilution: 1:250~1:500
Antigen ID: PP-059
Cross reactivity: Not tested
English
Deutsch
