PRR5 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ34565 fis, clone KIDNE2006210, highly similar to Homo sapiens proline rich protein 5 (PRR5), transcript variant 1, mRNA EMBL BAG52436.1

Protein Size: 379

Purification: Affinity Purified

• SKU: AVIARP56749_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56749_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55615
• Host: Rabbit