PSMA4 Antibody - N-terminal region : FITC

PSMA4 Antibody - N-terminal region : FITC
SKU
AVIARP56312_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA4

Key Reference: Amos,C.I., (2008) Nat. Genet. 40 (5), 616-622

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome subunit alpha type-4

Protein Size: 190

Purification: Affinity Purified

Subunit: alpha type-4
More Information
SKU AVIARP56312_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56312_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5685
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×