Rab17 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rab17 might be involved in transcellular transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rab17

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: GSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-17

Protein Size: 214

Purification: Affinity Purified

• SKU: AVIARP57631_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57631_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 19329
• Host: Rabbit