RAB22A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-22A

Protein Size: 194

Purification: Affinity Purified

• SKU: AVIARP57434_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57434_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 57403
• Host: Rabbit