RAB5C Antibody - middle region : FITC

RAB5C Antibody - middle region : FITC
SKU
AVIARP57818_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB5C

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-5C

Protein Size: 216

Purification: Affinity Purified
More Information
SKU AVIARP57818_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57818_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5878
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×