RAB9B Antibody - N-terminal region : FITC

RAB9B Antibody - N-terminal region : FITC
SKU
AVIARP56894_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB9B

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-9B

Protein Size: 201

Purification: Affinity Purified
More Information
SKU AVIARP56894_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56894_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51209
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×