RAI16 Antibody - N-terminal region : Biotin

RAI16 Antibody - N-terminal region : Biotin
SKU
AVIARP57653_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAI16

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM160B2

Protein Size: 743

Purification: Affinity Purified
More Information
SKU AVIARP57653_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57653_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64760
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×