Ralb Antibody - middle region : Biotin

Ralb Antibody - middle region : Biotin
SKU
AVIARP56507_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ralb is a multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Ralb accomplishes its multiple functions by interacting with distinct downstream effectors. It acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. It is required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Ralb plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. It is required for suppression of apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Ralb

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: EHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Ral-B

Protein Size: 206

Purification: Affinity Purified
More Information
SKU AVIARP56507_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56507_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64143
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×