RALGPS2 Antibody - N-terminal region : HRP

RALGPS2 Antibody - N-terminal region : HRP
SKU
AVIARP57091_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human RALGPS2

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-specific guanine nucleotide-releasing factor RalGPS2

Protein Size: 279

Purification: Affinity Purified
More Information
SKU AVIARP57091_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57091_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55103
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×