RANGAP1 Antibody - N-terminal region : Biotin

RANGAP1 Antibody - N-terminal region : Biotin
SKU
AVIARP56509_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGA

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANGAP1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ran GTPase-activating protein 1

Protein Size: 587

Purification: Affinity Purified
More Information
SKU AVIARP56509_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56509_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5905
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×