RASGRF1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRF1

Key Reference: Iguchi,T., (2007) Int. J. Oncol. 31 (2), 285-291

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-specific guanine nucleotide-releasing factor 1

Protein Size: 489

Purification: Affinity Purified

Specificity#: Predicted to recognized both human RASGRF1 isoforms (145, 55kD)

• SKU: AVIARP56516_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56516_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5923
• Host: Rabbit