RASL12 Antibody - N-terminal region : Biotin

RASL12 Antibody - N-terminal region : Biotin
SKU
AVIARP56945_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASL12

Key Reference: Pulverer,B.J., (2005) Science 307 (5715), 1621-1625

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-like protein family member 12

Protein Size: 266

Purification: Affinity Purified
More Information
SKU AVIARP56945_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56945_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51285
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×