RB1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophospho

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RB1

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: AEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Retinoblastoma-associated protein

Protein Size: 928

Purification: Affinity Purified

• SKU: AVIARP58066_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58066_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5925
• Host: Rabbit