RBBP4 Antibody - N-terminal region : HRP

RBBP4 Antibody - N-terminal region : HRP
SKU
AVIARP56648_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP4

Key Reference: Scuto,A., (2007) Cancer Res. 67 (21), 10317-10324

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histone-binding protein RBBP4

Protein Size: 425

Purification: Affinity Purified
More Information
SKU AVIARP56648_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56648_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5928
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×