RBBP7 Antibody - middle region : Biotin

RBBP7 Antibody - middle region : Biotin
SKU
AVIARP56518_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded p

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBBP7

Key Reference: Thakur,A., (2007) Mol. Cancer Res. 5 (2), 171-181

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone-binding protein RBBP7

Protein Size: 425

Purification: Affinity Purified
More Information
SKU AVIARP56518_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56518_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5931
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×