Rfc1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rfc1 is a transcriptional repressor that regulates transcription of the vasoactive intestinal peptide receptor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rfc1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Replication factor C subunit 1

Protein Size: 656

Purification: Affinity Purified

• SKU: AVIARP56521_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56521_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 89809
• Host: Rabbit