RGS22 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RGS22

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 147kDa

Peptide Sequence: Synthetic peptide located within the following region: QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulator of G-protein signaling 22

Protein Size: 1264

Purification: Affinity Purified

• SKU: AVIARP55320_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55320_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26166
• Host: Rabbit