RHOC Antibody - N-terminal region : FITC

RHOC Antibody - N-terminal region : FITC
SKU
AVIARP55742_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RHOC

Key Reference: Sousa,J.F. (er) BMC Cancer 8, 19 (2008)

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho-related GTP-binding protein RhoC

Protein Size: 193

Purification: Affinity Purified
More Information
SKU AVIARP55742_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55742_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 389
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×