RHOF Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state.It causes the formation of thin, actin-rich surface projections called filopodia. And it functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin- based morphology.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOF

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho-related GTP-binding protein RhoF

Protein Size: 211

Purification: Affinity Purified

• SKU: AVIARP57309_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57309_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54509
• Host: Rabbit