RHOJ Antibody - middle region : HRP

RHOJ Antibody - middle region : HRP
SKU
AVIARP57431_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOJ

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho-related GTP-binding protein RhoJ

Protein Size: 214

Purification: Affinity Purified
More Information
SKU AVIARP57431_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57431_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57381
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×