Rimklb Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rimklb catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate. Beta-citryl-glutamate is synthesized more efficiently than N-acetyl-aspartyl-glutamate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rimklb

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FRAVVMDEMVLTVEQGNLGLRISGELISAYPQVVVVRVPTPWVQSDSDIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Beta-citryl-glutamate synthase B

Protein Size: 387

Purification: Affinity Purified

• SKU: AVIARP57439_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57439_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 108653
• Host: Rabbit