RMND1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RMND1

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Required for meiotic nuclear division protein 1 homolog

Protein Size: 449

Purification: Affinity Purified

• SKU: AVIARP57061_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57061_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55005
• Host: Rabbit