RNF128 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: RNF128 is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of RNF128 in retrovirally transduced T cell hybridoma significantly inhibits activation-induced IL2 and IL4 cytokine production. Induced expression of RNF128 was observed in anergic CD4(+) T cells, which suggested a role in the induction of anergic phenotype.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF128

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase RNF128

Protein Size: 402

Purification: Affinity Purified

• SKU: AVIARP59127_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59127_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79589
• Host: Rabbit