RORG Antibody - N-terminal region : Biotin

RORG Antibody - N-terminal region : Biotin
SKU
AVIARP59154_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORG

Molecular Weight: 56 kDa

Peptide Sequence: Synthetic peptide located within the following region: DSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: nuclear receptor ROR-gamma

Protein Size: 518

Purification: Affinity purified
More Information
SKU AVIARP59154_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59154_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Human Gene ID 6097
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×