Rprd1b Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Rprd1b interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptional regulator which enhances expression of CCND1. It promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. It prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. It also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Rprd1b promotes cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rprd1b

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulation of nuclear pre-mRNA domain-containing protein 1B

Protein Size: 224

Purification: Affinity Purified

• SKU: AVIARP57533_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57533_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 70470
• Host: Rabbit