RPS27L Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS27L

Key Reference: Goto,Y., (2006) FEBS Lett. 580 (7), 1833-1838

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 40S ribosomal protein S27-like

Protein Size: 84

Purification: Affinity Purified

• SKU: AVIARP56775_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56775_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51065
• Host: Rabbit