Rps6ka2 Antibody - C-terminal region : Biotin

Rps6ka2 Antibody - C-terminal region : Biotin
SKU
AVIARP56169_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rps6ka2 is a serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. May function as tumor suppressor in epithelial ovarian cancer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rps6ka2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLHVDPQQRLTAVQVLKHPWIVNREYLSQNQLSRQDVHLVKGAMAATYF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosomal protein S6 kinase alpha-2

Protein Size: 733

Purification: Affinity Purified
More Information
SKU AVIARP56169_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56169_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 20112
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×