RSPH10B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human R10B2

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: THTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: radial spoke head 10 homolog B; radial spoke head 10 homolog B2

Protein Size: 280

Purification: Affinity Purified

• SKU: AVIARP56026_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56026_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 222967
• Host: Rabbit