RUBCN Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a negative regulator of autophagy and endocytic trafficking and controls endosome maturation. This protein contains two conserved domains, an N-terminal RUN domain and a C-terminal DUF4206 domain. The RUN domain is involved in Ras-like GTPase signaling, and the DUF4206 domain contains a diacylglycerol (DAG) binding-like motif. Mutation in this gene results in deletion of the DAG binding-like motif and causes a recessive ataxia. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0226

Molecular Weight: 103kDa

Peptide Sequence: Synthetic peptide located within the following region: DQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: run domain Beclin-1-interacting and cysteine-rich domain-containing protein

Protein Size: 927

Purification: Affinity Purified

• SKU: AVIARP58950_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58950_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9711
• Host: Rabbit