SAMD8 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAMD8

Key Reference: Jin,Y.J., (2005) Science 307 (5715), 1621-1625

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sphingomyelin synthase-related protein 1

Protein Size: 326

Purification: Affinity Purified

• SKU: AVIARP58524_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58524_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 142891
• Host: Rabbit