SCAND2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCAND2

Key Reference: 0

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative SCAN domain-containing protein 2

Protein Size: 152

Purification: Affinity Purified

• SKU: AVIARP58173_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58173_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54581
• Host: Rabbit